Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-GMFG Mouse Monoclonal Antibody

Fornitore: Abnova
Mouse monoclonal antibody raised against a full-length recombinant GMFG.

Type: Primary
Antigen: GMFG
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Effettua il login per visualizzare i prezzi a te riservati, le promozioni VWR e la disponibilità a magazzino
  Memorizza il mio account in questo dispositivo
 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
Up to 5 Clones 1 ABNOH00009535-M
Codice articolo fornitore:: H00009535-M
Codice articolo locale:: ABNOH00009535-M

Specifiche

Antigene GMFG
Nome antigene Glia maturation factor, gamma
Reattività Human
Coniugazione Unconjugated
Clonabilità Monoclonal
Tipo anticorpo Primary
Host Mouse
Western Blot Yes
ELISA Yes
Sinomini antigene GMF-GAMMA
Numero amminoacido 1 to 142
ID gene 9535
Formato Liquid
Assorbimento incrociato No
Immunogeno GMFG (NP_004868.1, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequenza MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Select Product:

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità