Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-CDK20 Mouse Monoclonal Antibody [clone: 885CT27.1.1]

Fornitore: Abgent
Type: Primary
Antigen: CDK20
Clonality: Monoclonal
Clone: 885CT27.1.1
Conjugation: Unconjugated
Epitope: N-terminal
Host: Mouse
Isotype: IgG1
Reactivity: Human



Effettua il login per visualizzare i prezzi a te riservati, le promozioni VWR e la disponibilità a magazzino
  Memorizza il mio account in questo dispositivo
 

Ordine

Espandi tutto / Chiudi tutto
Conf Codice catalogo VWR Quantità
400 µl ABGEAM2214B
Codice articolo fornitore:: AM2214B
Codice articolo locale:: ABGEAM2214B

Specifiche

Antigene CDK20
Nome antigene Cyclin-dependent kinase 20
Reattività Human
Coniugazione Unconjugated
Clonabilità Monoclonal
Tipo anticorpo Primary
Clone 885CT27.1.1
Host Mouse
Isotipo IgG1
Western Blot Yes
ELISA Yes
Sinomini antigene PNQALRE, CDCH, CCRK, P42
ID gene 23552
Epitopo N-terminal
Concentrazione 0.38
Immunogeno Purified His-tagged CCRK protein was used to produced this monoclonal antibody.
Peso molecolare 38.695 kDa
Purificazione Protein G Purification
Sequenza MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Tampone di conservazione pH 7,4
Temperatura di conservazione Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at – 20 °C in small aliquots to prevent freeze-thaw cycles
Temperatura di spedizione 4 °C
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Select Product:

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità