Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SPR Rabbit Polyclonal Antibody

Fornitore: US Biological
Type: Primary
Antigen: SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
100 µg 100 µG USBI133798
Codice articolo fornitore: 133798
Codice articolo locale: USBI133798

Specifiche

Antigene SPR
Nome antigene sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Reattività Human
Coniugazione Unconjugated
Clonabilità Polyclonal
Tipo anticorpo Primary
Host Rabbit
Isotipo IgG
Western blot Yes
Purificazione purified by Protein A chromatography
Sequenza MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Forma liquid
Tampone di conservazione PBS, pH 7,2.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità