Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SPO11 Mouse Polyclonal Antibody

Fornitore: US Biological
Type: Primary
Antigen: SPO11 (SPO11 meiotic protein covalently bound to DSB)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
50 µg 50 µG USBI133784
Codice articolo fornitore: 133784
Codice articolo locale: USBI133784

Specifiche

Antigene SPO11
Nome antigene SPO11 meiotic Protein covalently bound to DSB
Reattività Human
Coniugazione Unconjugated
Clonabilità Polyclonal
Tipo anticorpo Primary
Host Mouse
Isotipo IgG
Western blot Yes
Numero amminoacido 1 to 358
Purificazione purified by Protein A chromatography
Sequenza MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Forma liquid
Tampone di conservazione PBS, pH 7,2.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità
 

Un nuovo aspetto e un rinnovato impegno

Basato sulle funzioni e le risorse che conoscete, ottimizzato con l'innovazione di Avantor® Il nostro nuovo marchio simboleggia l'agilità e la nostra capacità di adattamento alle esigenze dei clienti.

ULTERIORI INFORMAZIONI INIZIA GLI ACQUISTI