Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SPLC2 Mouse Polyclonal Antibody

Fornitore: US Biological
Type: Primary
Antigen: SPLC2
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
50 µg 50 µG USBI133779
Codice articolo fornitore: 133779
Codice articolo locale: USBI133779

Specifiche

Antigene SPLC2
Reattività Human
Coniugazione Unconjugated
Clonabilità Polyclonal
Tipo anticorpo Primary
Host Mouse
Isotipo IgG
Western blot Yes
Numero amminoacido 1 to 249
Purificazione purified by Protein A chromatography
Sequenza MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Forma liquid
Tampone di conservazione PBS, pH 7,2.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità