Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-EPPIN Mouse Monoclonal Antibody [clone: 4G3]

Fornitore: US Biological
Type: Primary
Antigen: EPPIN (epididymal peptidase inhibitor)
Clonality: monoclonal
Clone: 4G3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgM Kappa
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
200 µl 200 µl USBI133775
Codice articolo fornitore: 133775
Codice articolo locale: USBI133775

Specifiche

Antigene EPPIN
Nome antigene Epididymal peptidase inhibitor
Reattività Human
Coniugazione Unconjugated
Clonabilità Monoclonal
Tipo anticorpo Primary
Clone 4G3
Host Mouse
Isotipo IgM kappa
Western blot Yes
ELISA Yes
Numero amminoacido 22 to 134
Formato ascites
Sequenza PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Forma liquid
Tampone di conservazione ascites fluid.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità
 

Un nuovo aspetto e un rinnovato impegno

Basato sulle funzioni e le risorse che conoscete, ottimizzato con l'innovazione di Avantor® Il nostro nuovo marchio simboleggia l'agilità e la nostra capacità di adattamento alle esigenze dei clienti.

ULTERIORI INFORMAZIONI INIZIA GLI ACQUISTI