Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SOX4 Mouse Monoclonal Antibody [clone: 2C5]

Fornitore: US Biological
Type: Primary
Antigen: SOX4 (SRY (sex determining region Y)-box 4)
Clonality: monoclonal
Clone: 2C5
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
100 µg 100 µG USBI133726
Codice articolo fornitore: 133726
Codice articolo locale: USBI133726

Specifiche

Antigene SOX4
Nome antigene SRY (sex determining region Y)-box 4
Reattività Human
Coniugazione Unconjugated
Clonabilità Monoclonal
Tipo anticorpo Primary
Clone 2C5
Host Mouse
Isotipo IgG1 kappa
ELISA Yes
Numero amminoacido 45 to 137
Purificazione purified by Protein A chromatography
Sequenza KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS*
Forma liquid
Tampone di conservazione PBS, pH 7,2.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità