Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SOS1 Mouse Monoclonal Antibody [clone: 4C1]

Fornitore: US Biological
Type: Primary
Antigen: SOS1 (son of sevenless homolog 1 (Drosophila))
Clonality: monoclonal
Clone: 4C1
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
100 µg 100 µG USBI133711
Codice articolo fornitore: 133711
Codice articolo locale: USBI133711

Specifiche

Antigene SOS1
Nome antigene son of sevenless homolog 1 (Drosophila)
Reattività Human
Coniugazione Unconjugated
Clonabilità Monoclonal
Tipo anticorpo Primary
Clone 4C1
Host Mouse
Isotipo IgG2a kappa
ELISA Yes
Numero amminoacido 313 to 421
Purificazione purified by Protein A chromatography
Sequenza SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK*
Forma liquid
Tampone di conservazione PBS, pH 7,2.
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità