Keep my session open?
Ending In 
The session is expired
La tua sessione è scaduta. Per favore rifare il login

Anti-SOHLH2 Rabbit Polyclonal Antibody

Fornitore: US Biological
Type: Primary
Antigen: SOHLH2 (spermatogenesis and oogenesis specific basic helix-loop-helix 2)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

Ordine

Espandi tutto / Chiudi tutto
Taglia Conf Codice catalogo VWR Quantità
100 µl 100 µl USBI133698
Codice articolo fornitore: 133698
Codice articolo locale: USBI133698

Specifiche

Antigene SOHLH2
Nome antigene spermatogenesis and oogenesis specific basic helix-loop-helix 2
Reattività Human
Coniugazione Unconjugated
Clonabilità Polyclonal
Tipo anticorpo Primary
Host Rabbit
Isotipo IgG
Western blot Yes
ImmunoPrecipitation Yes
Formato Serum
Sequenza MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Forma liquid
Temperatura di conservazione Cool
Temperatura di spedizione Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Seleziona tra i certificati dei lotti più recenti:

o
Confronta le alternative
Abbiamo individuato delle alternative che potrebbero farti risparmiare  per articolo.  Per confrontare gli articoli, puoi selezionare fino a 3 alternative proposte e cliccare "Confronta". Per aggiungerli al carrello inserisci una quantità e clicca "Aggiungi al carrello".

Prodotto originariamente selezionato:

Descrizione Codice catalogo Disponibilità Unità Il tuo prezzo Prezzo per Quantità